PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.111120.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 220aa    MW: 24773.6 Da    PI: 10.0417
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.111120.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.54.2e-153582148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W+ +Ed ll++ +  +G g+W++ a + g++Rt+k+c++rw++yl
   Cucsa.111120.1 35 RGPWSVDEDSLLIHSISVHGEGRWNLLAIRSGLRRTGKSCRLRWLNYL 82
                     89********************************************97 PP

2Myb_DNA-binding49.69.3e-1688131146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ +++E++l++d++ ++G++ W++Ia+ ++ gRt++++k++w++
   Cucsa.111120.1  88 RGNLSPQEQLLILDLHSRWGNR-WSKIAQQLP-GRTDNEIKNYWRT 131
                      7899******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.3563082IPR017930Myb domain
SMARTSM007172.0E-133484IPR001005SANT/Myb domain
SuperFamilySSF466892.06E-2834129IPR009057Homeodomain-like
PfamPF002491.1E-133582IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-193689IPR009057Homeodomain-like
CDDcd001672.02E-93782No hitNo description
PROSITE profilePS5129422.87383137IPR017930Myb domain
SMARTSM007172.0E-1387135IPR001005SANT/Myb domain
PfamPF002492.0E-1488131IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.5E-2290136IPR009057Homeodomain-like
CDDcd001671.56E-992131No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MASPCKNPSP SPSPSPSSSG SYSFIEDDQS EAVRRGPWSV DEDSLLIHSI SVHGEGRWNL  60
LAIRSGLRRT GKSCRLRWLN YLKPEVKRGN LSPQEQLLIL DLHSRWGNRW SKIAQQLPGR  120
TDNEIKNYWR TKVQKQAKIL NISTNSPEFK DIINRFWIPR LLHQINDSSS SSSSPPPPPH  180
TAATHPTPQF SDSDSLPAAD GKRRHFEQNS TSSESVEISQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-24351377108B-MYB
1mse_C8e-24351374105C-Myb DNA-Binding Domain
1msf_C8e-24351374105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818131e-115LN681813.1 Cucumis melo genomic scaffold, anchoredscaffold00030.
GenBankLN7132561e-115LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004137543.11e-158PREDICTED: myb-related protein 305-like
SwissprotP813915e-57MYB05_ANTMA; Myb-related protein 305
SwissprotQ9LDE13e-56MY108_ARATH; Transcription factor MYB108
TrEMBLW9QXC44e-79W9QXC4_9R
STRINGPOPTR_0012s05200.15e-77(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16393494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25340.18e-70myb domain protein 116